PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.013G019600.1
Common NamePOPTR_0013s02030g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YB
Protein Properties Length: 150aa    MW: 16858.8 Da    PI: 4.9002
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.013G019600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB163.82.4e-51398297
               NF-YB  2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
                        +eqd++lPianv+rimk++lP  akisk+ak+t+qec++efisfvt+easdkc++e+rkt+ngdd++wal++lGf+dy+e++  yl++yre+e
  Potri.013G019600.1  3 EEQDKLLPIANVGRIMKQILPPTAKISKEAKQTMQECATEFISFVTGEASDKCHKENRKTVNGDDICWALGSLGFDDYAEAIVRYLHRYREVE 95
                        69******************************************************************************************* PP

               NF-YB 95 gek 97
                        +e+
  Potri.013G019600.1 96 RER 98
                        997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.8E-502125IPR009072Histone-fold
SuperFamilySSF471134.03E-395126IPR009072Histone-fold
PfamPF008081.1E-26972IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.2E-163654No hitNo description
PROSITE patternPS0068503955IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.2E-165573No hitNo description
PRINTSPR006151.2E-167492No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MEEEQDKLLP IANVGRIMKQ ILPPTAKISK EAKQTMQECA TEFISFVTGE ASDKCHKENR  60
KTVNGDDICW ALGSLGFDDY AEAIVRYLHR YREVERERSA NQHKASGTEQ DIEESNHISF  120
QPQQQIEAPN GIEFRILDKG NGSSFTNPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B4e-40493392Transcription factor HapC (Eurofung)
4g92_B4e-40493392Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002319001.11e-110hypothetical protein POPTR_0013s02030g
SwissprotO040277e-56NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLB9I7Q31e-110B9I7Q3_POPTR; Uncharacterized protein
STRINGPOPTR_0013s02030.11e-109(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.14e-57nuclear factor Y, subunit B4